PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32015.9 Da    PI: 8.1361
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093277.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.3e-19141194356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+ ++ +eq  +Lee F+++++++ +++  LA++l+Lt rqV vWFqNrRa+ k
  XP_011093277.1 141 KKLRLCREQAAVLEESFREHNTLNPKQKMALAMQLNLTSRQVEVWFQNRRARTK 194
                     56667789********************************************98 PP

2HD-ZIP_I/II119.22.2e-38140229191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl +eq+++LEesF+e+++L+p++K++la +L+l+ rqv+vWFqnrRARtk kq+E+d+e+L+r +++l+een+rL+kev+eLr +l
  XP_011093277.1 140 RKKLRLCREQAAVLEESFREHNTLNPKQKMALAMQLNLTSRQVEVWFQNRRARTKFKQTEVDCEYLRRYCENLTEENRRLQKEVNELR-AL 229
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046189.3E-271116IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.7E-17115196IPR009057Homeodomain-like
PROSITE profilePS5007116.665136196IPR001356Homeobox domain
SuperFamilySSF466891.11E-17139205IPR009057Homeodomain-like
SMARTSM003892.6E-12140200IPR001356Homeobox domain
CDDcd000862.05E-13140194No hitNo description
PfamPF000463.7E-16141194IPR001356Homeobox domain
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PfamPF021834.8E-10196230IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-23196239IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MVEKDDGLGL SLSLKCLQNQ NSNPPPSPSP LPTAASPFPL NLFGCPLPNF MKQRKSSSTD  60
AYHESTADRN SEMRSLFRGI DVNLAITAAD VCDEELMVSS PNSTVSSVSG KRSEREENDG  120
ERDSSSLEIN DSDGGDAAGR KKLRLCREQA AVLEESFREH NTLNPKQKMA LAMQLNLTSR  180
QVEVWFQNRR ARTKFKQTEV DCEYLRRYCE NLTEENRRLQ KEVNELRALK LSPQFYTNTS  240
PPTTLTMCPQ CKRVAVPSSS SSTNTTSTPT ATTSGRISRL PTTGRCPL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188196RRARTKFKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093277.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP466022e-84HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-106A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.12e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-77homeobox protein 2